Protein Info for GFF1151 in Variovorax sp. SCN45

Annotation: Nitrogen regulatory protein P-II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 PF00543: P-II" amino acids 1 to 106 (106 residues), 114.1 bits, see alignment E=1.9e-37

Best Hits

Swiss-Prot: 73% identical to GLNB_PASMU: Nitrogen regulatory protein P-II (glnB) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K04751, nitrogen regulatory protein P-II 1 (inferred from 99% identity to vap:Vapar_2361)

MetaCyc: 71% identical to nitrogen regulatory protein PII-1 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Nitrogen regulatory protein P-II" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (112 amino acids)

>GFF1151 Nitrogen regulatory protein P-II (Variovorax sp. SCN45)
MKQITAIVKPFKLEDVREALAEVGVTGLTVTEVKGFGRQKGHTELYRGAEYVVDFLPKMK
VEVVVNEGDVERCIEAIVNSARTGKIGDGKIFVTEVERIVRIRTGEENENAV