Protein Info for GFF1148 in Sphingobium sp. HT1-2

Annotation: Nitrogen regulation protein NR(I), GlnG (=NtrC)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 90.7 bits, see alignment E=2.5e-29 TIGR01818: nitrogen regulation protein NR(I)" amino acids 7 to 468 (462 residues), 578.5 bits, see alignment E=5.1e-178 PF00158: Sigma54_activat" amino acids 141 to 307 (167 residues), 242.4 bits, see alignment E=7.3e-76 PF14532: Sigma54_activ_2" amino acids 142 to 312 (171 residues), 84.6 bits, see alignment E=2.7e-27 PF07724: AAA_2" amino acids 163 to 291 (129 residues), 32.6 bits, see alignment E=2.9e-11 PF00004: AAA" amino acids 165 to 293 (129 residues), 21.4 bits, see alignment E=1e-07 PF07728: AAA_5" amino acids 165 to 299 (135 residues), 34.5 bits, see alignment E=7e-12 PF02954: HTH_8" amino acids 429 to 469 (41 residues), 41.3 bits, see alignment 3.6e-14

Best Hits

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 88% identity to sch:Sphch_0704)

Predicted SEED Role

"Nitrogen regulation protein NtrC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>GFF1148 Nitrogen regulation protein NR(I), GlnG (=NtrC) (Sphingobium sp. HT1-2)
MAATGTVLVVDDDPAICVVVGEALRRQGHKVKIAGSIRERMALMESFSPDILITDVMLPD
GDGLDGVAEIIERKPDLNVIILSAQNTLNTAIRATEKGAFEYLPKPFDLNELTRAVADAL
GHRSGGADAAEQGLPHDGLPLVGRSPAMQEVYRTIARVLSNDLSILVLGESGTGKELVAE
AIHSLGQRRTRPFVAINMAAIPRELIEAELFGYEKGAFTGAQARTAGKFEQAQGGTLFLD
EIGDMPMEAQTRLLRVLQSGEVTTVGGSKPVRVDVRIIAATNKDLPRLIEENRFRQDLYY
RLNVVPVSLPPLRERREDVILLARHFLDRAAQDGLPRKALAEDAAQLLMAYHWPGNVREL
QNIMQRLAVLSRENVIAADMLRHALPLDAEPADHAAPAGQLAQAVREWTKRQLGVGLGQA
NPQLHDNLLAVIEPILLQETLASVDGNQIRAAGLLGINRNTLRKKLTDYGLDPLQLRLSD