Protein Info for GFF1147 in Sphingobium sp. HT1-2

Annotation: Nitrogen regulation protein NtrY (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 751 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 105 to 130 (26 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details PF19312: NtrY_N" amino acids 29 to 318 (290 residues), 405.9 bits, see alignment E=2.6e-125 PF00672: HAMP" amino acids 330 to 382 (53 residues), 60.4 bits, see alignment 4.2e-20 PF00512: HisKA" amino acids 506 to 572 (67 residues), 41.1 bits, see alignment E=3.6e-14 PF02518: HATPase_c" amino acids 616 to 728 (113 residues), 88.2 bits, see alignment E=1.3e-28 PF13581: HATPase_c_2" amino acids 624 to 724 (101 residues), 29.3 bits, see alignment E=2e-10

Best Hits

KEGG orthology group: K13598, two-component system, NtrC family, nitrogen regulation sensor histidine kinase NtrY [EC: 2.7.13.3] (inferred from 87% identity to sjp:SJA_C1-16720)

Predicted SEED Role

"Nitrogen regulation protein NtrY (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (751 amino acids)

>GFF1147 Nitrogen regulation protein NtrY (EC 2.7.3.-) (Sphingobium sp. HT1-2)
MTGAVTIPRRGQAWARLIRPYLRNGRLAAAIEAVTLILFLGTAGLTYRLLSGQDQSYTLL
TPPIVALLLVANLVPAIALLMLLGRRVAKRRAAKSAIGSDGQLHVRLVAIFSVVASVPML
LVVIFASLLFQYGVQFWFSDSARGMLQNASDLARGYYEQNLREVRDETLTMASDLRDYLG
QSSVSSPRFAEGYIYQVVTRKLNRSAIIEIGKDGVARTAATVDPESRPASEMLSADVVKR
LASGEDVVVAAKPNQIEAVTLLYPNSKIYLYATRNAGSSSFSNVERAQKVLGDYDLFAAQ
SRALQLRFNLLLFVGSLLLVGIAVYIALAVADWMVRPVNELVTAARKITAGDLSARVTSP
ASRDEIGTLASAFNRMTQRLEAQTGALVAANSQLDERRAFIEAILSGVSAGVLSVDRGGV
IQLLNSSAAAILVREGDDPVGRPLAEISAELAELVASQEDAGIVQVRAQGDLRTLAVKVS
EDVSGHILTFDDITQQLSDQRRAAWSDVARRIAHEIKNPLTPIQLAAERLQRRYGEEVTS
DKSTFARLTGTIVRQVGDLRRIVDEFSSFARMPKPVFRREALGDIARHALFLHEVAHPDI
RFAFEADAGEMEMVCDRRQLGQALTNIVKNAVEAIEPKPAPEDGGVRGHVRMRLHQADGA
LVIEVRDDGIGLPPERERILEPYMTTRSKGTGLGLAIVKKIVEEHMGEIRFDDAEGGGAR
VTLRFPVAALEKLEEGQVVALPKGKVTANGA