Protein Info for GFF1146 in Sphingobium sp. HT1-2

Annotation: NtrX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 PF00072: Response_reg" amino acids 5 to 116 (112 residues), 102.2 bits, see alignment E=3.8e-33 PF00158: Sigma54_activat" amino acids 143 to 304 (162 residues), 165.3 bits, see alignment E=2.1e-52 PF14532: Sigma54_activ_2" amino acids 144 to 309 (166 residues), 75.2 bits, see alignment E=1.2e-24 PF02954: HTH_8" amino acids 409 to 447 (39 residues), 33.2 bits, see alignment 6.9e-12

Best Hits

KEGG orthology group: K13599, two-component system, NtrC family, nitrogen regulation response regulator NtrX (inferred from 95% identity to sch:Sphch_0706)

Predicted SEED Role

"Nitrogen regulation protein NtrX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>GFF1146 NtrX (Sphingobium sp. HT1-2)
MALDILIVDDEEDIRDLVAGVLEDEGFTTRTAANSDSAIEALDSRRPSLVLLDVWLQGSK
LDGLELLDEIKRRDATVPVLMISGHGNIDTAVAAIRKGAADFIEKPFEADRLLHLVARAT
ETERLRRENQTLRARFGQDDELTGTSASINGVRATIKKVAGTGSRVLISGPAGVGKEVAA
RMLHSWSGRADAPFIIVAAARMDPDRVEEELFGVEDPSGLVRPGYLEQAHGGTLYLDEIA
DMPVTTQGKILRVLTDQSFTRVGGQRQVKVDVRVISSTARNLTAEIEERRFREDLFYRLN
VVPLQIPSLSERRDDIPPLVEHYLARFAADRRVNPPEIASDAMAALQANEWPGNVRQLRN
VIERTMILAPGDRIGRIELDMLPAELTSGGGGDGIGQSAIMGAPLREARESFEREYLRIQ
IRRFSGNISRTATFIGMERSALHRKLKLLGITDGKDG