Protein Info for GFF1144 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 152 to 168 (17 residues), see Phobius details amino acids 178 to 207 (30 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 260 to 287 (28 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details PF02366: PMT" amino acids 69 to 207 (139 residues), 32.2 bits, see alignment E=8.5e-12 PF13231: PMT_2" amino acids 73 to 237 (165 residues), 104 bits, see alignment E=1e-33

Best Hits

KEGG orthology group: None (inferred from 62% identity to xau:Xaut_1362)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (520 amino acids)

>GFF1144 hypothetical protein (Xanthobacter sp. DMC5)
VSVSTPGLARPGVGDRPAGLRTLQERISPASALAAVLVFALAVRLLFAATTGLGNDESYT
VVTSRIPALSYFDHPPMAWWLAHYSAVLFGSEAPLAVRAPFLLLSTLSTLLMYLLTARLF
GRWAGVWAALLMACAPVLGLTSATWVLPDGPLIAFLLAGTLVVAHVLFDERAHPAMWLLA
GAFGGLALLSKYHGVFLFAGTFLFLLLCPRQRKWLGTVWPYAGGVIALALFSPVIAWNVG
NGFASLAFQSARASAAGFHPLMALMVVGGIALFLTPWIWVGLVAAAVRALRARPVNPRAL
LLICLAAGPVLVFPVVAAWSGAKPFFHWAAPGYLMLFPLLGRATARRWAANAAIRGWTVW
SAGFTAAGVAVIATVSLVPSLGTAFSATGGDPLRELATWSDLDAAIRRQGLTPGPYTFVV
TPVWHMGGKVGYALGPSWPVACMGDDCRGFLMSDIQHGRTGVDAVLVLDAAGADAQMNAM
RRRFQSVESLGTVEIRHAGTAVALVVLATGHGYLGDASPR