Protein Info for GFF1142 in Sphingobium sp. HT1-2

Annotation: Xanthine/uracil/thiamine/ascorbate permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 54 to 82 (29 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 138 to 155 (18 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 292 to 314 (23 residues), see Phobius details amino acids 327 to 345 (19 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 385 to 412 (28 residues), see Phobius details amino acids 424 to 442 (19 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 24 to 401 (378 residues), 151.1 bits, see alignment E=1.8e-48

Best Hits

Swiss-Prot: 41% identical to AZG1_PAELB: Nucleobase transporter PlAzg1 (PL1_1235) from Paenibacillus larvae subsp. larvae (strain NRRL B-3650 / LMG 16245)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 66% identity to aex:Astex_1941)

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>GFF1142 Xanthine/uracil/thiamine/ascorbate permease family protein (Sphingobium sp. HT1-2)
MTAPLSSWLDSRFQIAARGSNVRTEIVAGITTFLTMAYIVLVNPAILGEAGMPLVGVAAA
TCFAAAFASILMGMVANVPLALAPGMGLNAYFTYSVVLGLGIPWPVALGCVFLSGVAFLA
LTLAGIRQMILAAIPPHLLAAIAGGIGLFIAFIGLRNAGIVVSNSATSVALGDLRSAPVL
LTLFGLTLIAGLSIRQVRGAILIGIVATTLIGWLVGALHFTPTPYDVSALGSTAFHLDLG
AVFAGSHGIGVLEIIFVFLFVDLFDNLGTLMAVTKRAGLARPDGSVPNLNRILIADAAAT
MVGATAGTSTVTSYVESAAGVAAGGRTGLTAIVTGLLFLITIFAAPYAGLVPLYATAPAL
ILVGSLMMAPLVEVSWEEPFEAVPAFLTLALIPLTFSIANGIAFGIVAHAILKLLRGKMS
RADWLLFLLAILIVIRFAWVAAA