Protein Info for GFF1140 in Variovorax sp. SCN45

Annotation: Domain of unknown function / Efflux ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 189 to 212 (24 residues), see Phobius details amino acids 233 to 259 (27 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details amino acids 305 to 330 (26 residues), see Phobius details amino acids 360 to 383 (24 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 25 to 376 (352 residues), 158.8 bits, see alignment E=2e-50 PF01061: ABC2_membrane" amino acids 242 to 345 (104 residues), 38 bits, see alignment E=1.3e-13

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 59% identity to dac:Daci_4570)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>GFF1140 Domain of unknown function / Efflux ABC transporter, permease protein (Variovorax sp. SCN45)
MSLRGFSAASARREFALLRTRPWDLAMISWVPLLAVFLIWWIFSAGLPERLPIGVLDQDH
SSLSRQLVRFLDATPGLRVVQQYSDEGEMARALTSGAVDAAVQLPRDLSRDVKQGRVGQV
VLLHNAQLGTHSSLIQRDVRTAVATVSGGVELAVRNKRGESMTAARVSMEPIKASMVALF
NTSTDYEQFLGAALIPALLHILAMTAGAWAVGRELRDRSIGAWLGAAPRWHEALAALAGK
LALPFLSLSAVAIAAMVWITAGRGWHPVGSLGWTLFALVVFLALSIALGAFASSLTRSLR
TALSATGFITAPAFAFGGVGFPLVAMPFFARMWANLLPYTHYIRVQMEQLQMGAPVLYSV
ATPLWMVLGTAVLLAASAAALVRAARAPDTWGGR