Protein Info for GFF1139 in Variovorax sp. SCN45

Annotation: Domain of unknown function / Efflux ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 191 to 216 (26 residues), see Phobius details amino acids 229 to 253 (25 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 24 to 370 (347 residues), 166.1 bits, see alignment E=1.2e-52 PF01061: ABC2_membrane" amino acids 238 to 338 (101 residues), 40.9 bits, see alignment E=1.7e-14

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 62% identity to dac:Daci_4569)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>GFF1139 Domain of unknown function / Efflux ABC transporter, permease protein (Variovorax sp. SCN45)
MPTDDRTRFGAAWRDTALAVLRDKGVLLIMLIAPIIYGFFYPWPYGTQAVTRVPVAVVDQ
DHSALSRQIARFAMANPRLDVRMVTSDVHEAQQALWRGEIEGYALLPADLKRSVLRGTSA
VVTIEGNGAYALLNKAVLYGFSEAVGTVSAGVEIRKLQAGGQSAVQAARSRSPLNTQLVA
LFNPTEGYGSYVVPAVALLILQQTLLMGAAMLAGTWAEAGRLRATMGAWLGRLGALSGFG
FLSGLFYFGWVFFLQDYPRGGNPLGAMVLLAFYVPAICTLGLLLGCWFRDRERALQVLLF
TALPMAFLSGFSWPVEALPGPLQALRWVFPSTAGIQGSLRLNQMGAPLHDVLPYIGVMLA
LTLAGLLTLWLAATPRGNTEPRRA