Protein Info for GFF1139 in Sphingobium sp. HT1-2

Annotation: Efflux ABC transporter, permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 212 to 226 (15 residues), see Phobius details amino acids 260 to 294 (35 residues), see Phobius details PF00664: ABC_membrane" amino acids 27 to 295 (269 residues), 60.1 bits, see alignment E=2.8e-20 PF00005: ABC_tran" amino acids 368 to 515 (148 residues), 118.7 bits, see alignment E=3e-38

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 47% identity to swi:Swit_4550)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (581 amino acids)

>GFF1139 Efflux ABC transporter, permease/ATP-binding protein (Sphingobium sp. HT1-2)
VSQFRQISDFARFSLGGYGRQASVILLLILIGSILESCSLLAMIPLLKLIGTNHGAAQSS
IQLPWIGSISLGWLLTAMLCLMVFQALVSRRRLLLMTRTMQQAVDDIRMRLFTAIGYGRW
SLVANMRGSDLNHALSNDVDRIQVAVFSLMSFGQNIIWLTLYGLLSTLISWQMTLFAMTV
GAATLFGLYPVRRKIARHAQSMSNSLQERQYVAFEFITGMKIAKAFNSEPYYLQRLDRLL
ETLRVGTVEFARLTSNSTALFQLASGAAAALFVYVAYAVIALPLPQLMTMLLLFMRLAPR
FNALQSTLQQLLLCLPGYENVARLLRIFTAEQNRTAGPERVQMPLLTRHVRFDRVSITHH
GADTPTIANLDLELPAGKIIALVGPSGAGKSTIADMLMGLLDPSEGQILVDGVNLAQDDR
QWRSQIAYMPQDVFLLHDSIATNLRIGKADASDEELWNALDAANARQFVGALPQGLDTVV
GDRGSRLSGGERQRIALARALLRHPRLLILDEATSALDIDAQTKIETAIAGLRGHITILA
IAHTASLVALADITVHLDRGRVVQVRTNNPVKDEDVVAAAE