Protein Info for GFF1131 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 206 to 230 (25 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 305 to 305 (1 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 8 to 326 (319 residues), 127.5 bits, see alignment E=3.1e-41

Best Hits

KEGG orthology group: None (inferred from 51% identity to sjp:SJA_C2-01890)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>GFF1131 hypothetical protein (Sphingobium sp. HT1-2)
MSPGRHIPALDGIRGFAALLVVFCHFRTFGYPELLHPRAGDYGVLLFFTLSGFLMGHLYL
PRTPDRDALASYAAARIARIVPLYACVSLLSFLIYRFVYADFIYPIGLIELVRQGTFTST
VSVFWSIGPEFQFYFLFPAIWAATHAKQPLRGWLYVLIGLIVAGCYAASPWLPGIFALAK
MHIFMTGILCAVLVRQIPEDRMTRLFPPLLLFAAAFIWVLIAPPASVSAWVFPPVTNDPK
HIIYYADPLKIVACALVILGTAIRHPFNDMLWGNPLMRRLGAYSFSLYLLHMPILQLVRL
AGPAWGISMPMQILIATILSLAVAGLSHEMFERPAGNWVRRKLTDALNGHAATRPLPLAA
ESPSS