Protein Info for GFF1130 in Variovorax sp. SCN45

Annotation: Fatty acid hydroxylase family (carotene hydroxylase/sterol desaturase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 125 to 150 (26 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 92 to 221 (130 residues), 78.1 bits, see alignment E=4.3e-26

Best Hits

KEGG orthology group: None (inferred from 90% identity to vpe:Varpa_2527)

Predicted SEED Role

"putative desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (244 amino acids)

>GFF1130 Fatty acid hydroxylase family (carotene hydroxylase/sterol desaturase) (Variovorax sp. SCN45)
MLWGLLFFGGIYLGFGGLTWLLTKRLLPALGIGRVLDPRPLQPGQLRRELGQSGVSVLIF
GLGMVFPWGLLQLGWARLDGDAGWLRITLEILVLAIWNDVHFWVNHRLLHTRWLRRFHGP
HHRSFVTTPWATYSFHPIEALMLGNVILLPMVVHDFSFWSLAAVPVFSLFFNCVGHSNYD
FFTGVSYSHWFAASRRHHLHHAVHNGNYGFQFTFMDRLFRTRIAADAAEPLFQAFRKKHG
TAAA