Protein Info for GFF1130 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 242 to 272 (31 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 342 to 367 (26 residues), see Phobius details amino acids 379 to 408 (30 residues), see Phobius details

Best Hits

KEGG orthology group: K13662, putative polymerase (inferred from 66% identity to sjp:SJA_C2-01900)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>GFF1130 hypothetical protein (Sphingobium sp. HT1-2)
LAEIALSLPARARHDAVHRRSLIHDRLVNYVAAGLLVATVLFNPALAWVNAHLFPMTAGI
VSAAQGSIVLTALLVGTMQPVQHSFRWLALTWIMVLSALLTSAIKGYFEPKILGDILLIP
AFILLGTRIEGALLRQTVLSLQLLIMLVGLWELASPGGFGSTFRVIDYYVQTRGYDADAF
WAGGDLFLSSERPGGRMLLDGLGLHRGSSLFLEPVSLGNWAIVGTIFTAAMWRSLSNGAR
LFMLVSTAVLLVTCDGRLALSVILLFCLYLPISAYVPDQWSVAYLPLLLVALVGGEALGI
LAEHQDNLPGRLSVGLDALRSMDLDQLLGIRADRVRFDDAGWADFVQAQSVVIAIGLWLA
LACSSFGRDPGNRMAKHGIMLFLALCLPISNSLLSIKTAALMWVVYGFCYARGRLTRMEG
NAA