Protein Info for GFF113 in Variovorax sp. SCN45

Annotation: ABC transporter, ATP-binding protein (cluster 3, basic aa/glutamine/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 53% identical to GLNQ_GEOSE: Glutamine transport ATP-binding protein GlnQ (glnQ) from Geobacillus stearothermophilus

KEGG orthology group: None (inferred from 69% identity to pao:Pat9b_4933)

MetaCyc: 53% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"ABC transporter ATP-binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>GFF113 ABC transporter, ATP-binding protein (cluster 3, basic aa/glutamine/opines) (Variovorax sp. SCN45)
VLIESVEKHFGDNHVLRGVSTEVAKGDIVALVGRSGSGKSTLLRCVNGLETISAGRIVVD
GVDVQSPDTDLALLRRRVGMVFQSFNLFPHLSAAANVTLAPVLTRKIAKGEARDLAKRML
ERVGLGHKLDAMPSQLSGGQQQRVAIARALAMSPQLMLFDEATSALDPELVGEVLRVMED
LARDGMTMMVVTHEMAFARRVASEVLFMNQGRIWERGTPERMFGSPQTPEFQQFVQSVV