Protein Info for GFF1129 in Xanthobacter sp. DMC5

Annotation: putative protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF04174: CP_ATPgrasp_1" amino acids 71 to 402 (332 residues), 521.8 bits, see alignment E=6.6e-161 PF14403: CP_ATPgrasp_2" amino acids 71 to 447 (377 residues), 559.5 bits, see alignment E=3.4e-172

Best Hits

Swiss-Prot: 50% identical to Y335_SYNY3: Uncharacterized protein sll0335 (sll0335) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 93% identity to xau:Xaut_3540)

Predicted SEED Role

"Protein containing domains DUF404, DUF407"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>GFF1129 putative protein (Xanthobacter sp. DMC5)
MPHAFDEMSSTDGGVRPAYETLQRWLAEVPQDVLDHRRKEAEFIFRRIGITFAVYGEQNA
QERLIPFDIVPRILTKDEWSRLSRGLEQRVKALNMYIKDVYSKREILKAGVVPENLVYQN
PAFRPEMNGQRVPHDLYVHIAGIDIVRTDPDKFYVLEDNARTPSGVSYMLENREIMLRLF
PELFSMHRVAPVENYADDLLATLRSLSPHGGHEPNVVILTPGIHNSAYYEHSFLADKLGV
DLVEGRDLFVKDAVVYMRTTEGPKRVDVIYRRLDDDFLDPLAFRRDSVLGVPGLMSAYQA
GNVTLTNAVGTGVADDKAVYSYMPDIIKFYLGEEPLLPNVPTWRCREADHLKYVLEHLPE
LVVKEVHGSGGYGMLVGPASDKAQIEKFRDKLKADPANFIAQPTLALSTCPTLVEKGIAP
RHVDLRPFILSGSDKVRIVPGGLTRVAMKEGSLVVNSSQGGGTKDTWVLDA