Protein Info for GFF1129 in Variovorax sp. SCN45

Annotation: Cardiolipin synthase (EC 2.7.8.-) phosphatidylethanolamine-utilizing, bacterial type ClsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13091: PLDc_2
  • amino acids 76 to 229 (154 residues), 46.3 bits, E=4e-16
  • amino acids 327 to 463 (137 residues), 73.2 bits, E=1.9e-24
• PF00614: PLDc
  • amino acids 415 to 441 (27 residues), 24 bits, see alignment (E = 3e-09)

Best Hits

KEGG orthology group: None (inferred from 90% identity to vpe:Varpa_2526)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

• cardiolipin biosynthesis II (3/3 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Glycerophospholipid metabolism
• High-mannose type N-glycan biosynthesis
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Protein Sequence (524 amino acids)

>GFF1129 Cardiolipin synthase (EC 2.7.8.-) phosphatidylethanolamine-utilizing, bacterial type ClsC (Variovorax sp. SCN45)
MNAWLLPLRIALASLLIAALGACGSLPVARERPAENAAAADLTTPLAAIVAASTPPGEHS
GFRLMPLGVYSLDARIQLAQRAQRSLVVQYYQLENDAVGRLLLRTLREAAARGVKVRVLV
DDLYTVKSQQLLLALSETPNVEVRLFNPFCCGRNGFLSRFAASPFEIGRLNHRMHNKLFI
ADGVMAVVGGRNIAEEYFVLSEAQNFIDMDALVVGKVVPQLESIFDAYWNSVQVWPIADI
VAGEGGRKPGTADFDDWVNMAAPPPKIVLPPSDILGYGPIAEELDGGRMGLLWGEARAIA
DPPTKPATMTADEAIATSVTMQVWALMLDAKTEVDLTSPYLVPGERGMAAFQELTQRKVK
LTLVTNSLAANDEPLVHTGYARYRERLLQSGADLYELSPQRTSAGERFGMFGKSLGRLHA
KTAAIDKTRIFIGSMNLDPRSASQNTEMGLVVESPQLAREMLRVINISKLQNSYRLRLAK
GTGTLQWLTNDGEKEMILTSEPESSFFQRFYNMLIAPVVPEMLL