Protein Info for GFF1127 in Xanthobacter sp. DMC5

Annotation: UDP-N-acetylglucosamine 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 8 to 241 (234 residues), 49.5 bits, see alignment E=9.7e-17 PF01370: Epimerase" amino acids 8 to 243 (236 residues), 193.4 bits, see alignment E=1.3e-60 PF02719: Polysacc_synt_2" amino acids 8 to 234 (227 residues), 41.2 bits, see alignment E=3.7e-14 PF16363: GDP_Man_Dehyd" amino acids 9 to 329 (321 residues), 166.8 bits, see alignment E=2.7e-52 PF01073: 3Beta_HSD" amino acids 10 to 235 (226 residues), 48.1 bits, see alignment E=2.5e-16

Best Hits

Swiss-Prot: 54% identical to CAPI_STAAU: Protein CapI (capI) from Staphylococcus aureus

KEGG orthology group: K01795, [EC: 5.1.3.-] (inferred from 66% identity to gau:GAU_2706)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>GFF1127 UDP-N-acetylglucosamine 4-epimerase (Xanthobacter sp. DMC5)
LTFTKAPIFVTGAAGFIGAAVAERLLAMGQTVVGIDDLNAYYDVRLKEARLARLMSHPGF
SFERLTLADRAATADLFARHRPSHVVHLAAQAGVRYSIEHPETYIDSNLVGFGNVLEGCR
HGGVAHLVYASSSSVYGANTDLPFRVEQTVDHPISLYAATKKANELMAHAYSHLYRLPVS
GLRFFTVYGPWGRPDMAVFLFTDAIWHGRPIKVFNNGDMQRDFTFIDDVVDAVVALLPKP
ATPDPAWTGADPDPATSNAPYRIYNVGNHSPEPLMALISQIEEALGRKAELDFQPMQAGD
VQATFADVTSLAQAVDFAPRTPLKEGVARFATWYREVWLGQIAKDD