Protein Info for GFF1126 in Xanthobacter sp. DMC5

Annotation: UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 300 to 324 (25 residues), see Phobius details TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 37 to 486 (450 residues), 451 bits, see alignment E=6.5e-139 TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 37 to 485 (449 residues), 418.2 bits, see alignment E=5.2e-129 PF13727: CoA_binding_3" amino acids 84 to 262 (179 residues), 66.2 bits, see alignment E=3.9e-22 PF02397: Bac_transf" amino acids 298 to 482 (185 residues), 235.8 bits, see alignment E=2.6e-74

Best Hits

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (487 amino acids)

>GFF1126 UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase (Xanthobacter sp. DMC5)
MSLSTDNMRVERASEAHRSGVTPTLDYASMPPLFVVADVVLILGLSVLVDFLFSTQSSSG
FEVTQPIGIGILAAVAFVLTTISRGLYKPWRMVRVVEEVRATMVNWTFAILVVATVIFCL
KVAGSTSRVSTGAFAVLGFFALPAARWAMAVWLRRAIASGAVKGRATILVGDAGELAKVV
PAHMLVRLGLNEVRRFSLSTPDGSAKELLSASDKDALKAALQFARQHRVEEIVLAMPWSD
VDRLDAVRARLRSVPLPVKLLPDEIISELLDAPRVDFGSSIAIEVQRAPLSRFELAQKRL
LDIAVASCAVLLLLPLFAIIATAIKLDSRGPVIFRQRRNGFGGREFTIYKFRSMTVMEDG
TKVVQAQRNDKRVTRVGRFLRASSLDELPQVLNVLFGQMSIVGPRPHAIAHDDEYSKLIS
GYAFRHHVKPGITGWAQVQGFRGETAELEQMERRIEMDLWYINNWSVWIDIKIIMKTFLE
VLRKEAY