Protein Info for GFF112 in Sphingobium sp. HT1-2

Annotation: Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY (EC 2.3.1.n3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 86 to 103 (18 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase" amino acids 7 to 195 (189 residues), 164.8 bits, see alignment E=1.1e-52 PF02660: G3P_acyltransf" amino acids 14 to 186 (173 residues), 175.7 bits, see alignment E=4.2e-56

Best Hits

Swiss-Prot: 66% identical to PLSY_NOVAD: Glycerol-3-phosphate acyltransferase (plsY) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 90% identity to sch:Sphch_0775)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>GFF112 Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY (EC 2.3.1.n3) (Sphingobium sp. HT1-2)
MTPPWLLPAFVLVLGYLLGSIPFGLLLTRFTGAGDLRQIGSGNIGATNVLRTGRKGLAAA
TLLLDLLKGAAAVLIGAALVDGGGPMAGAMAFIGHCYPVWLRFAGGKGVATMMGVVTAMY
WPAGIVFAVVWLGALFGTKWSSVGGMSAAVSAPIAMFAFGRIDLVPVSLALALIVLWRHR
ANIARLMKGEEPKVGSSKQKAATE