Protein Info for GFF1116 in Sphingobium sp. HT1-2

Annotation: NAD-dependent epimerase/dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 10 to 189 (180 residues), 41.7 bits, E=2.7e-14
• PF01370: Epimerase
  • amino acids 10 to 224 (215 residues), 131.7 bits, E=1.1e-41
• PF05368: NmrA
  • amino acids 10 to 122 (113 residues), 47.2 bits, E=8.4e-16
• PF01073: 3Beta_HSD
  • amino acids 11 to 220 (210 residues), 94 bits, E=3e-30
• PF16363: GDP_Man_Dehyd
  • amino acids 12 to 177 (166 residues), 83.2 bits, E=9.1e-27
• PF13460: NAD_binding_10
  • amino acids 14 to 169 (156 residues), 68.8 bits, E=2.1e-22
• PF07993: NAD_binding_4
  • amino acids 62 to 174 (113 residues), 35.8 bits, E=1.8e-12

Best Hits

KEGG orthology group: None (inferred from 68% identity to sjp:SJA_C2-02040)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• colanic acid building blocks biosynthesis (7/11 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (3/7 steps found)
• UDP-sugars interconversion (4/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Protein Sequence (332 amino acids)

>GFF1116 NAD-dependent epimerase/dehydratase (Sphingobium sp. HT1-2)
MNEIGYQPIIAVTGATGFVGGALARQLLQMGYRVRSMCRRPLTEAERESGIEWIEGSLTD
TDRFDALLRDARYCFHIAAMFRTEGPRKAFMQVNRDATRALLEASRRAGVERFIYCSSIG
VHGNVADAPADENAPFDPRDPYQESKLRAEDLCRDEMGRPGMSVVIVRPCSTYGPGDTRM
LKLFRLVQRRRFLFAGRQTPNFHPVYIDDLVAGYILTMVHPDAPSGTFILGDRAFLPLRD
YVRAVATALDVPPPKTTIPYSLALMAARLCEALYAPLGLQPPLPRRRLTIFRHNRAFSIR
RAQTVLGYQPLINLEEGFRRTITWYRQQGMLA