Protein Info for GFF1114 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 10, nitrate/sulfonate/bicarbonate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 13 to 31 (19 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 128 to 162 (35 residues), see Phobius details amino acids 194 to 219 (26 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 98 to 268 (171 residues), 97.8 bits, see alignment E=3.4e-32

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 93% identity to vap:Vapar_2336)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>GFF1114 ABC transporter, permease protein (cluster 10, nitrate/sulfonate/bicarbonate) (Variovorax sp. SCN45)
MPRANFGLNERNARFWQLALLVLILIAWHLASRNQQFAFFVGEPIQVAGRIWSWFLPFEV
PANALFPEGLKGNADIYLHLGTTLLETVLAFGIGTVLGLACGLWLALAPTASLILDPYIK
AANSMPRVILAPIFALWFGLGIWSKVALAVTLVFFIVFFNVYQGVREVSPVVLANAKMLG
ASQRQLLRTVYLPSATSWVFSSLHTSVGLAFVGAVVGEYLGSARGVGYLILQAEGTFDVN
TVFAGIVVLTAFALVLDGIVGLIEKRLMKWQPKTGETEKL