Protein Info for GFF1113 in Sphingobium sp. HT1-2

Annotation: Two-component system sensor histidine kinase/response regulator hybrid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 653 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 59 to 92 (34 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details PF00989: PAS" amino acids 149 to 252 (104 residues), 36.6 bits, see alignment E=1.4e-12 amino acids 268 to 377 (110 residues), 45.5 bits, see alignment E=2.5e-15 TIGR00229: PAS domain S-box protein" amino acids 151 to 256 (106 residues), 37.3 bits, see alignment E=1.4e-13 amino acids 263 to 388 (126 residues), 65.2 bits, see alignment E=3.2e-22 PF08448: PAS_4" amino acids 153 to 256 (104 residues), 25.1 bits, see alignment E=6.2e-09 amino acids 273 to 382 (110 residues), 36.5 bits, see alignment E=1.8e-12 PF13426: PAS_9" amino acids 154 to 253 (100 residues), 35.4 bits, see alignment E=4e-12 amino acids 277 to 380 (104 residues), 49.9 bits, see alignment E=1.2e-16 PF13188: PAS_8" amino acids 269 to 320 (52 residues), 39.9 bits, see alignment 9.3e-14 PF02518: HATPase_c" amino acids 517 to 623 (107 residues), 88.6 bits, see alignment E=1.4e-28 PF14501: HATPase_c_5" amino acids 518 to 607 (90 residues), 23.6 bits, see alignment E=1.5e-08

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (653 amino acids)

>GFF1113 Two-component system sensor histidine kinase/response regulator hybrid (Sphingobium sp. HT1-2)
MPISKAGQVRASFSLVRLRCLRRHVSWSGVSRYLVGLAMVAIALAPFQADEYPSFSSEFY
VIFTFVALFTTMLFGAGPGFLAGIAALAVTYLLEGFHGGLLAAGAFLMALVAANVVALRA
TFWRARAEYQAAHVGRLMTQMKLLTDGAAHYALYMTDVSGFILHWNRGAERFTGWLTGEV
MHRHVALLYPGRAEIKARMAQAFAFARQHGSWEFDHECCRSDGTIYLQNCVVTALYDNDG
ALQGFANLIRDVTLERAHELALQEREHELRLILETAPDAVFVFDADGCIEYINEAASRMF
GYDLVDLKGQNFESLLLVCPSEDEVPDEHPFRIVDVSEKIERQLIGRHHNGSNFPTEMTF
VRMEANGGTRFTAFVRDLSEQEATKARLETLQAEMLDGTRYSAMGAMASMLSHELTQPLT
ALAAYMEGGSILLNNLNGGSRAKLDEIFHLASSEAVRAGAIMRHLRDFTSSGEAQLEVQD
IGEMVRSSIALVRPAAARAQVRVVLRVAPDAGPVFADPVQIQQVIGNLCRNAIDAMRNMD
ERILTIHASRVDELTTQVMITDTGSGIAAEIRERLFDAFVTTKEEGTGVGLSICRTIVEA
HGGRIWVEPAPAGSCFCFTLKRKKGILCGGNEDDSHRGRRIFRQSGNGILVGA