Protein Info for GFF111 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Candidate type III effector Hop protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 PF07005: SBD_N" amino acids 3 to 225 (223 residues), 225.1 bits, see alignment E=1.1e-70 PF17042: NBD_C" amino acids 240 to 409 (170 residues), 132.6 bits, see alignment E=2e-42

Best Hits

Swiss-Prot: 100% identical to DTNK_SALTY: D-threonate kinase (dtnK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 99% identity to sty:STY0184)

MetaCyc: 100% identical to D-threonate 4-kinase (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN-18596 [EC: 2.7.1.219]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.219

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>GFF111 Candidate type III effector Hop protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKMIVIADDFTGSNDTGVQLAKKGARTEVMLSASQKPSRRADVLVINTESRAMPADQAAS
AVYAALSPWCETSPAPLVYKKIDSTFRGNIGAEVTAAMRASQRKLAVIAAAIPAAGRTTL
EGKCLVNGVPLLETEFASDPKTPIVSSRIAEIVALQSEIPVYEVFLQDVRRGGLSALLTA
YAAEGEGIIVVDAVEERDLTLIAQAACEQPSMPLLVGAAGLANALPVELFMQDRQRLPVL
VVAGSMSEATRRQVDNALCRGRAEVVDIDAARMVSDSAEQEIASVVEQACALLSQHRHTI
LRTSRRAEDRQLIDALCEKSAMSRQQLGERLSQRLGVVTLNIIEQARIGGLFLTGGDIAT
AVAGALGAEGYRIQSEVAPCIPCGTFVNSEIDDLPVITKAGGFGSDSTLCDALYYIEEMY
CGD