Protein Info for GFF1108 in Xanthobacter sp. DMC5

Annotation: GDP-L-fucose synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 11 to 70 (60 residues), 31.6 bits, E=1.4e-11
• PF01370: Epimerase
  • amino acids 13 to 242 (230 residues), 209 bits, E=1.1e-65
• PF16363: GDP_Man_Dehyd
  • amino acids 43 to 266 (224 residues), 63 bits, E=5.4e-21

Best Hits

Swiss-Prot: 62% identical to FCL_SINFN: GDP-L-fucose synthase (fcl) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02377, GDP-L-fucose synthase [EC: 1.1.1.271] (inferred from 67% identity to rec:RHECIAT_CH0000850)

MetaCyc: 57% identical to GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase (Arabidopsis thaliana col)
GDP-L-fucose synthase. [EC: 1.1.1.271]

Predicted SEED Role

"GDP-L-fucose synthetase (EC 1.1.1.271)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 1.1.1.271)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (10/11 steps found)
• GDP-L-fucose biosynthesis I (from GDP-D-mannose) (2/3 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (8/14 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.271

Protein Sequence (315 amino acids)

>GFF1108 GDP-L-fucose synthase (Xanthobacter sp. DMC5)
MRMVYGLAGKRVWVAGHQGMVGSAIMRRLAREDCILISAARSELDLKDQAAVRAFVERER
PQAVFLAAAKVGGILANDTFPADFLYDNLMIEANVVEASFRCGVEKLLVLGSSCVYPRLA
PQPMNEDALLTGPLEPTHEWYAVAKIAGIKLAQAYRRQHGCDFISALPTNLYGPGDNFDP
ATSHVMAALIRKAHEAKVRGDRQLVVWGTGTPRREFLHVDDCADALVLLMRAYSGPAPVN
VGSGTDETILDIARMVCASVGFEGEIVQDTSKPDGPPRKLMSNDRLRDLGWAPAIGLPEG
IAHTYAAFLDELVGA