Protein Info for PS417_05620 in Pseudomonas simiae WCS417

Annotation: alkyl hydroperoxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF08534: Redoxin" amino acids 5 to 146 (142 residues), 60.4 bits, see alignment E=2.7e-20 PF00578: AhpC-TSA" amino acids 5 to 139 (135 residues), 116.2 bits, see alignment E=1.4e-37 PF10417: 1-cysPrx_C" amino acids 160 to 194 (35 residues), 53 bits, see alignment 4.2e-18

Best Hits

Swiss-Prot: 55% identical to AHPC_HELPY: Alkyl hydroperoxide reductase C (ahpC) from Helicobacter pylori (strain ATCC 700392 / 26695)

KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 100% identity to pfs:PFLU1152)

MetaCyc: 36% identical to alkyl hydroperoxide reductase, AhpC component (Escherichia coli K-12 substr. MG1655)
R4-RXN [EC: 1.11.1.26]

Predicted SEED Role

"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UB06 at UniProt or InterPro

Protein Sequence (200 amino acids)

>PS417_05620 alkyl hydroperoxide reductase (Pseudomonas simiae WCS417)
MSVLVGKQAPDFDVPAVLGNGEIVDSFKLSEAIKGKYGLVFFYPLDFTFVCPSELIALDH
RMDDFKARNVEVVAVSIDSHFTHNAWRNTAINDGGIGKVKYTMAADMKHDIAKAYDVESE
GGVAFRGAFLIDDKGVVRSQIINDLPLGRNMEELIRLVDALQFHEEHGEVCPANWKKGDK
GMNASPEGVAAYLTENAGKL