Protein Info for GFF1105 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Hypothetical fimbrial chaperone ycbF precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF00345: PapD_N" amino acids 10 to 131 (122 residues), 122.2 bits, see alignment E=1.3e-39 PF02753: PapD_C" amino acids 153 to 210 (58 residues), 54.4 bits, see alignment E=1.3e-18

Best Hits

Swiss-Prot: 44% identical to YCBF_ECOLI: Uncharacterized fimbrial chaperone YcbF (ycbF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to stm:STM0027)

Predicted SEED Role

"Hypothetical fimbrial chaperone ycbF precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>GFF1105 Hypothetical fimbrial chaperone ycbF precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
LLPISWAQAGVVIGGTRFIYHAGAPALSVPVSNRSEASWLIDTHILPGGRWPGTKNEGNI
MPFVVTPPLFMLSARQENSMRVVYTGAPLPADRESLFTLSIAAIPSGKPEANRVQMAFRS
ALKLLYRPDGLAGNPQQAYRHLIWSLTPDGATVRNPTPYYVTLFLLRANERAQDNAGVVA
PFATRQTDWCRHTVRCTVRWQSINDYGRVMPAQTVDLTRIH