Protein Info for GFF1103 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 236 to 262 (27 residues), see Phobius details amino acids 311 to 334 (24 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details amino acids 404 to 424 (21 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>GFF1103 hypothetical protein (Xanthobacter sp. DMC5)
MSRILSFRRVGLTFSAQLYNQVVVLGVQLLQVPFLLAAWGSERYGGWLVLYAVPSYLTLT
DFGFTMVAKNQMVIHAAKSDRAGVLRVYHSVFALLLVAAAVIFGACFLGIESFSLTSAFA
LGPLSETAAKQTILFLIASVVINQFLLLLGAGVRASGRPAAEVTWGATSRLLEGVCTVAV
ALVTTRVELAALAVLISRIGVVGAMWAWLRAVAPDIPLGLKGARLDEIRRMVNPSFSYML
IGLAQAIAIQGPVVLLGALATTTETVLFSTSRTLARMGTSAANLVNFSCAPEYSRLHGEG
NRAAFARLRKIHILIGIVGIIAYGIGLWALGPFIMELWTHGKVAVVYPFFALMNGAVAAE
MLWGCLFTPIAAINRHVRLSYIFVGLTMVCAILAYSWALSWGATGVAAALLLLHGAMSVF
VLLLRPRG