Protein Info for GFF1101 in Sphingobium sp. HT1-2

Annotation: Capsular polysaccharide biosynthesis/export periplasmic protein WcbC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF02563: Poly_export" amino acids 86 to 179 (94 residues), 57.5 bits, see alignment E=1.3e-19 PF22461: SLBB_2" amino acids 272 to 366 (95 residues), 27.9 bits, see alignment E=2.1e-10

Best Hits

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 56% identity to sjp:SJA_C1-30150)

Predicted SEED Role

"Capsular polysaccharide biosynthesis/export periplasmic protein WcbC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>GFF1101 Capsular polysaccharide biosynthesis/export periplasmic protein WcbC (Sphingobium sp. HT1-2)
MRELTPAISARAQLLLAACSLALAGCSSLGASGPTSSSVKNAGQESVANAPIKVVDLNAD
VASRVMAANKTVEFAEALGDGRAAGTTVGLGDALDIAIWEAPPASLFGTMVPDSRIPSSS
SGLARSASLPEQMVDTEGRISIPFAGSIQVVGLTPQQVGQAIVARLRGKAHNPQVVVRLS
RVVNNNVTVVGDVSENARVALTPKGERLLDVLASVGGVKQPVGKTLIQITRGAQTATMPL
EAVIKNPRQNIRLQSDDIVTALFQPFSFTALGATGNSAEINFEGTGLTMAQALGRVGGLR
DDRADVRGVFIFRLERPEALDPAVAATAQKTPDGKIPVIYRLDLKNPASFFIAQGFPVQN
KDVLYISNAPLADIQKFVNIISQMAFSIININNTIR