Protein Info for GFF110 in Xanthobacter sp. DMC5

Annotation: Fluoroacetate dehalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 33 to 287 (255 residues), 85.4 bits, E=5e-28
• PF12697: Abhydrolase_6
  • amino acids 34 to 292 (259 residues), 46.2 bits, E=9.6e-16

Best Hits

Swiss-Prot: 58% identical to DEHA_RHOPA: Fluoroacetate dehalogenase (RPA1163) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K01561, haloacetate dehalogenase [EC: 3.8.1.3] (inferred from 87% identity to xau:Xaut_3097)

Predicted SEED Role

"alpha/beta hydrolase fold"

MetaCyc Pathways

• fluoroacetate degradation (1/1 steps found)
• 1,2-dichloroethane degradation (3/4 steps found)
• butachlor degradation (1/6 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.8.1.3

Protein Sequence (303 amino acids)

>GFF110 Fluoroacetate dehalogenase (Xanthobacter sp. DMC5)
VSDLSDLFPGFASHYVDTKAGRIFLRQGGTGAPLLLLHGFPQSHVMWHRVAPKLAEQHTL
IIPDLPGYGWSAAPEGGTDHFPYSKRAMAAAMVEVMENLGFAHFSVMGHDRGARAAYRLG
LDHPGRLDRLVVLDIVPTYVMWHRMDRARALQVYHWAMLAQPKPLPEKLVGANPAWFLDW
TMASWTAHKDLSAFDPRAMAAYRAAISSPDRLHAMCEDYRAGATIDLAHDEADIAAARTL
SCPTLALWGAAGIPSRGASPLEAWKAFAPQVEGQAIEAGHFLAEEAPKATLDVAMPFLAQ
GRP