Protein Info for GFF1094 in Sphingobium sp. HT1-2

Annotation: Antirestriction protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF08401: ArdcN" amino acids 8 to 128 (121 residues), 141.6 bits, see alignment E=1.5e-45 PF18818: MPTase-PolyVal" amino acids 155 to 278 (124 residues), 176.1 bits, see alignment E=3e-56

Best Hits

Swiss-Prot: 40% identical to Y4EC_SINFN: Uncharacterized protein y4eC (NGR_a03900) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 63% identity to oan:Oant_3149)

Predicted SEED Role

"Antirestriction protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF1094 Antirestriction protein (Sphingobium sp. HT1-2)
MGTGNGSLYDDVTQHIIAQLEEGRLPWVQPWDTSLTATGLPRNAATGRCYSGVNILILWD
RLFERGYGAQRWLTYRQAQALGGNVRKGEAGTTVCYADRFTPKDEQQKARDEQREARQVA
FLKRFTLFNVEQCEGLPEELMTVTEARPFEELVPQAHRLIRACGADIRVGGESAFYAPSP
DYIRVPDQAAFHEPINWYRTILHELGHWTGHASRLDRLTGTNFGSDDYAREELCAEMASA
FLCAELGIVPTVRHADYIGGWLEVLREDNRAIFRAASQASKAAHYLLDFLPAQGSDHD