Protein Info for GFF1092 in Xanthobacter sp. DMC5

Annotation: Heme exporter protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 15 to 41 (27 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 127 to 153 (27 residues), see Phobius details amino acids 161 to 185 (25 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details PF03379: CcmB" amino acids 5 to 219 (215 residues), 238.5 bits, see alignment E=2.8e-75 TIGR01190: heme exporter protein CcmB" amino acids 8 to 219 (212 residues), 256.7 bits, see alignment E=8.1e-81

Best Hits

Swiss-Prot: 65% identical to CCMB_BRADU: Heme exporter protein B (cycW) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02194, heme exporter protein B (inferred from 96% identity to xau:Xaut_3854)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>GFF1092 Heme exporter protein B (Xanthobacter sp. DMC5)
MIAAFLAIVRRDLALSLGSGGGAGLGVVFFLSVVTVVPFAVGPDLVLLARIGPAILWIGA
LLASLIGLERLFAADAEDGSLDALTLSTLPLELTAAAKGLAHWLATGLPLVLAAPVLALM
LNLEPAAIGAVVLTLLVGTPAVTFLGLIGAAFAGAFRRGGLLIAVLVIPLTIPVLIFAVS
ATQAAVVGPVPFGTPFRVLAGLALFALVLGPVAAAAALRAARA