Protein Info for PS417_05525 in Pseudomonas simiae WCS417

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF00072: Response_reg" amino acids 5 to 111 (107 residues), 105.3 bits, see alignment E=7.4e-34 PF00158: Sigma54_activat" amino acids 143 to 309 (167 residues), 242.4 bits, see alignment E=7.5e-76 PF14532: Sigma54_activ_2" amino acids 144 to 314 (171 residues), 60.4 bits, see alignment E=8.7e-20 PF00004: AAA" amino acids 167 to 285 (119 residues), 26.6 bits, see alignment E=2.5e-09 PF07728: AAA_5" amino acids 167 to 287 (121 residues), 29.9 bits, see alignment E=1.7e-10 PF25601: AAA_lid_14" amino acids 315 to 397 (83 residues), 89.8 bits, see alignment E=3e-29 PF02954: HTH_8" amino acids 416 to 456 (41 residues), 46.7 bits, see alignment 7.3e-16

Best Hits

Swiss-Prot: 46% identical to ATOC_ECOLI: Regulatory protein AtoC (atoC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU1132)

Predicted SEED Role

"Two component, Sigma-54 Specific, central transcriptional regulator of acidic amino acid uptake"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGQ9 at UniProt or InterPro

Protein Sequence (465 amino acids)

>PS417_05525 Fis family transcriptional regulator (Pseudomonas simiae WCS417)
MTHNILVVDDEPKLCDLLASALGQNDVQVFIAGNGLHALKVLEQEDIDLVISDWRMPGMD
GPALLAEIKVRYPHVPVIVMTAYSTVKNAVQSMRNGAYDYIAKPFDIDELDITVAKALQF
RDIMRDNARLRAELDEHAQFDSLVGDSPAFRKVLQAVDSVRDSSATILLTGESGTGKEMV
ARAIHKHGSRADKPFVAVNCAAIPEGLLESEMFGHRKGAFTGAVADRVGRFQQADKGTLF
LDEVGDMPLALQAKILRALQERVIEPVGDPRERKVDVRVIAATNKNLLDAVANKEFREDL
YYRLNVFPIPLPSLRERVEDIAPLARHFAQTLSATAGKRITGFSAEALQAMAAYHWPGNI
RELQNCVERATIVAASPVIEDIDLPGYLFASKPNQGDVTAILSDGPGIPQDLDAALAEVE
KAYILAALQESNGVQAAAAAKIGISERSFWYRLKKLGIQVDKIVR