Protein Info for GFF1084 in Xanthobacter sp. DMC5

Annotation: putative MFS-type transporter YcaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 17 to 39 (23 residues), see Phobius details amino acids 51 to 74 (24 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 243 (221 residues), 78.2 bits, see alignment E=5.6e-26 amino acids 213 to 385 (173 residues), 68.3 bits, see alignment E=5.9e-23

Best Hits

KEGG orthology group: None (inferred from 89% identity to xau:Xaut_3861)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>GFF1084 putative MFS-type transporter YcaD (Xanthobacter sp. DMC5)
MHAPHGSLGHMSRTASIAAAISAITVVGVGISLSIPLLALELESRGIANKWIGINTAVAG
IATIFTAPFVPLLVRKMGLRALLVGAIILAAASLVGFKAAPSFLMWFPLRFAFGAALCIL
FAVSEFWINALAPPNRRGLIMGIYATALSLGAALGPTILSVLGASGWAPYLAGAVVLLLG
AIPILLARGITPRIHDDSHHGVLTFVRRSPSAVLAALVFGAIETAVMTFLPLYGLRLGLS
ETSAALLLTAAVLGNVAFQIPIGLISDKVDRRVLLFCCSLAGAAGAFTLPFVPVSSPWFL
AMIFLATGVVGSLYTVGLAHLGERFHGADLAAANAAFVMLYSVGLIAGPPLAGAGMDLYN
PYGFAFVISTMLAVYAAIVAGRLMTRGRRAA