Protein Info for GFF1081 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 142 to 159 (18 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 337 to 354 (18 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 387 to 405 (19 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (560 amino acids)

>GFF1081 hypothetical protein (Variovorax sp. SCN45)
MEIEQNVSAVFDYTGAVFRLVGYHPALFRLAGLAAIMLSAVAFWAGFQKLLLIMFPGAKH
AQHLRLNSLLFIQLGGILYYQWAFATPNYYTLTAISLNLFAGFVMWALALETLKPRNVHT
TFFFGVAGLALGSGVFVRFTSAALVLGCLFALLWYWPGVGRMRRIRLLLTVGVGMVVWSG
FHFIAVQGPVRQWEMFTHGWQLYQAIGTHSPGAKIFAYPRDLFALGLAAFLAFWPCHLLV
AAALLVPRVARRRFALLAIFRPSVVAALVLVVAAVLSWRVGANVLASRLPASGGVSIYLS
FYSAWILVLIAVYALFAMQPADVRPECDPAAMQCRGLVLFLLGLPIAGSVGTANPLYNVI
SFYAVPWFGLVFLLGLALIARYKARPALLLGVMAVMGGVTCSQVVQGSVQAPSQVSTGLQ
LQAIPTEVGFPAHWMKLDSESHKLIEQLRAAAVRSGFTPGDDIVAVSYLPGLVYAMGGRS
PGHPTFLLGTPGYLAYSKMALGFAEKARVRAALVLLDLDAHDAELQLLLGSAEMDFPAGY
NLLGEVTAGDKTYRLFKPSL