Protein Info for GFF108 in Sphingobium sp. HT1-2

Annotation: S-adenosylmethionine:diacylgycerolhomoserine-N- methyltransferase, BtaB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF13489: Methyltransf_23" amino acids 39 to 184 (146 residues), 57.1 bits, see alignment E=8.6e-19 PF01209: Ubie_methyltran" amino acids 41 to 156 (116 residues), 42.7 bits, see alignment E=2e-14 PF13847: Methyltransf_31" amino acids 42 to 164 (123 residues), 57.5 bits, see alignment E=6.5e-19 PF01135: PCMT" amino acids 42 to 132 (91 residues), 21.7 bits, see alignment E=7e-08 PF13649: Methyltransf_25" amino acids 45 to 145 (101 residues), 69.5 bits, see alignment E=1.5e-22 PF02390: Methyltransf_4" amino acids 45 to 122 (78 residues), 28.3 bits, see alignment E=5e-10 PF08242: Methyltransf_12" amino acids 46 to 147 (102 residues), 59.1 bits, see alignment E=2.6e-19 PF08241: Methyltransf_11" amino acids 46 to 147 (102 residues), 57.7 bits, see alignment E=7.1e-19

Best Hits

KEGG orthology group: K13623, S-adenosylmethionine-diacylgycerolhomoserine-N-methlytransferase (inferred from 58% identity to pgv:SL003B_3327)

MetaCyc: 52% identical to diacylglycerolhomoserine N,N,N-trimethyltransferase (Cereibacter sphaeroides)
2.1.1.M42 [EC: 2.1.1.M42]

Predicted SEED Role

"Mlr1575 protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.M42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>GFF108 S-adenosylmethionine:diacylgycerolhomoserine-N- methyltransferase, BtaB protein (Sphingobium sp. HT1-2)
MSGHGQLMDGVYRYQRHIYDLTRKYYLLGRDGLIADLDPPAGGAVLEIGCGTGRNLIAVG
KAWPKARLYGVDISEAMLDTARASVAKAGMADRVTLAQGDACGFDPQALFGRASFERVFI
SYALSMIPEWEMALVQAARCVAPGGKLEIVDFGQQDELPALWKRALFGWLEHFHVSPRRE
LNGAINRLAQDMGGFPHVRTLYRGYAVRGGLIRV