Protein Info for PS417_05450 in Pseudomonas simiae WCS417

Annotation: GNAT family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF13302: Acetyltransf_3" amino acids 2 to 140 (139 residues), 40.8 bits, see alignment E=1.1e-13 PF13420: Acetyltransf_4" amino acids 3 to 158 (156 residues), 39 bits, see alignment E=2.6e-13 PF00583: Acetyltransf_1" amino acids 36 to 139 (104 residues), 71.2 bits, see alignment E=2.7e-23 PF13673: Acetyltransf_10" amino acids 44 to 144 (101 residues), 46.3 bits, see alignment E=1.3e-15 PF13508: Acetyltransf_7" amino acids 58 to 140 (83 residues), 49 bits, see alignment E=2e-16 PF08445: FR47" amino acids 83 to 141 (59 residues), 28.4 bits, see alignment E=3.9e-10

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfs:PFLU1117)

Predicted SEED Role

"acetyltransferase, GNAT family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U5F7 at UniProt or InterPro

Protein Sequence (170 amino acids)

>PS417_05450 GNAT family acetyltransferase (Pseudomonas simiae WCS417)
MIIRTLGASDAEAYRALMLEAYGAYPQAFTSSVAERAAMPLSWWEKRLSSPLDCLLGVFV
GDELAGIVGLAYEPREKARHKVTLFGMYVNEAYQQQGLGRQLVEAALDEARKQPRLKVIQ
LTVTAGNDAAFALYQRCGFVQYGLEPLAVRVGVDYFDKIHMWRELPGSCN