Protein Info for GFF1074 in Sphingobium sp. HT1-2

Annotation: Holliday junction ATP-dependent DNA helicase RuvA (EC 3.6.4.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF01330: RuvA_N" amino acids 3 to 62 (60 residues), 65.5 bits, see alignment E=5.5e-22 PF14520: HHH_5" amino acids 75 to 132 (58 residues), 47.2 bits, see alignment E=3.9e-16 PF07499: RuvA_C" amino acids 156 to 200 (45 residues), 42.3 bits, see alignment 1.3e-14

Best Hits

Swiss-Prot: 65% identical to RUVA_ERYLH: Holliday junction ATP-dependent DNA helicase RuvA (ruvA) from Erythrobacter litoralis (strain HTCC2594)

KEGG orthology group: K03550, holliday junction DNA helicase RuvA (inferred from 87% identity to sjp:SJA_C1-00990)

Predicted SEED Role

"Holliday junction DNA helicase RuvA" in subsystem DNA-replication or RuvABC plus a hypothetical

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>GFF1074 Holliday junction ATP-dependent DNA helicase RuvA (EC 3.6.4.12) (Sphingobium sp. HT1-2)
MAMIAKLKGRLDSTGIDHAIIDVGGVGYLVGASSRTLAALGPVGEAVTIHTEMLVAEDSI
RLVGFARAEERDWYRLLTHVQGVGSRVALAILSALEPLELHRAIMMGDKAMIARANGVGP
KLAQRIVNELKDKIGAAPAGAPGMPGVVALPTGSFAADALSALQNLGFKPAEASGAVAAA
EEELGDGASLDALVRLALRKAAK