Protein Info for GFF1072 in Sphingobium sp. HT1-2

Annotation: protein of unknown function DUF1345

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details PF07077: DUF1345" amino acids 34 to 204 (171 residues), 181.2 bits, see alignment E=7.2e-58

Best Hits

KEGG orthology group: None (inferred from 75% identity to sjp:SJA_C1-00970)

Predicted SEED Role

"protein of unknown function DUF1345"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>GFF1072 protein of unknown function DUF1345 (Sphingobium sp. HT1-2)
MAKMQKRSTLFPWRYGMFLMLLLSIAPLMLWLPWHEAVMGGFDLAAIAFCLAAVPLIDSD
PAQMRRKAVLNDANRQLMLLLTGVVCIVILVAVGVAASAPGHPDAESVVLLLATLVIAWL
FSNLVYAMHYAHAFYLADDKGKDAGGLDFPDTDEPVYWDFLYFGFTLGMTFQTSDVSITS
TGMRRTATFHCLAAFVFNLGILAFTINVLGG