Protein Info for PS417_05435 in Pseudomonas simiae WCS417

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 624 PF00072: Response_reg" amino acids 55 to 152 (98 residues), 33.8 bits, see alignment E=5e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 192 to 349 (158 residues), 121.1 bits, see alignment E=1.9e-39 PF00990: GGDEF" amino acids 192 to 347 (156 residues), 141.1 bits, see alignment E=4.2e-45 PF00563: EAL" amino acids 369 to 602 (234 residues), 245.6 bits, see alignment E=6.9e-77

Best Hits

KEGG orthology group: None (inferred from 84% identity to pfs:PFLU1114)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1UN48 at UniProt or InterPro

Protein Sequence (624 amino acids)

>PS417_05435 diguanylate cyclase (Pseudomonas simiae WCS417)
MTPDSARANRRILIVDDSASIHDDFRKILCANAQGEKSLDSLEETLFGTTATPRHAFVLD
SAYQGQEALELVARSLAANAPYAMVFIDMRMPPGWDGLQTIEQLWNVDPNLQIALCTAYS
DYSFEAIEARLKYNDQLLILKKPFDHLEIRQMASALTWKWQLAQDVALKVVALERTIEER
VQELLKVSHLLQYDALTELPNSTLLGDRLSQAIALGRRHDTQLAVIFIGLDRFKRINNAL
GYPVGDEVLQHVSHSLVATVRSSDSVFRYGSDEFVILLHDVQHPQQTQHIAHKVLKAISA
TRHVAGHDLSITASLGISIYPNDSYNTVELIKHAETAMHNSKERGPNDFSFYTEDMNLRA
RRQQNLESAIRLALELDEFVLHYQPKLDLNSGRIVGAEALIRWFQPRSGWVSPSDFIPVA
EDSGLIVPLTQWVLHQACEQAQAWRGMGLPPLYMAVNVSAIDFRQHDFVDNLAAILKQTG
LPPAWLELEITENVLMQNVDDTVQILQTIKAMGVRLALDDFGTGYSSLSYLRRFPIDVLK
IDQSFVRGLNENNQDAQLISAIIGMGKSLELNIIAEGVETVEQLNFLKSQQCEEGQGFLF
SKAVPPKDFARLLQVGSATLMPAQ