Protein Info for GFF1071 in Sphingobium sp. HT1-2

Annotation: GTP-binding protein EngA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 100 to 124 (25 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 225 to 249 (25 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details amino acids 306 to 330 (25 residues), see Phobius details PF04140: ICMT" amino acids 324 to 403 (80 residues), 24.1 bits, see alignment E=3.9e-09 PF06966: DUF1295" amino acids 339 to 412 (74 residues), 21.4 bits, see alignment E=1.6e-08

Best Hits

KEGG orthology group: None (inferred from 79% identity to sjp:SJA_C1-00960)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>GFF1071 GTP-binding protein EngA (Sphingobium sp. HT1-2)
LLTNIGYKPGPMSKSADPCPKSAVSHGVGLAGLVGLGLWTLVARHYGMNGPNAGLAAVVA
CGIPMVLWSLLVDKVHRNPSTGVDWNAPARSVRSMLDISLVKIAGLWATWLAIAVCYCIG
RWYWTGSYRFAMDLLMAAAPWLLLLSIPYVIWLDRRLVEPRDACFAFGQWVIGGAAGKAD
MAQVANHARAWAVKGFFTAFMISIVPGNFSSVIDWRLDDLLHNPVALTGFLIGIMFMIDV
CMATVGYLLTMKPLDSHIRTANPYLGGWLAALLCYPPFVMMGAGGPFDYHGGGAEWDVWT
RGMPALQWGLGALLVLLTAIYAWATVAFGIRFSNLTHRGILTHGPYRWTRHPAYLTKNLF
WWFSSLPFLTTTGSLTDMVRNCALLGVTNAVYYWRAKTEEQHLSADPAYQAYSDWMARNA
PVPRFFAWVVGRKPDAPRETQPAE