Protein Info for GFF1069 in Xanthobacter sp. DMC5

Annotation: Toluene-4-monooxygenase system, ferredoxin component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 PF13806: Rieske_2" amino acids 2 to 98 (97 residues), 44.1 bits, see alignment E=1.7e-15 PF00355: Rieske" amino acids 3 to 88 (86 residues), 58.3 bits, see alignment E=5.7e-20

Best Hits

Swiss-Prot: 30% identical to TMOC_PSEME: Toluene-4-monooxygenase system, ferredoxin component (tmoC) from Pseudomonas mendocina

KEGG orthology group: None (inferred from 84% identity to xau:Xaut_4301)

MetaCyc: 49% identical to toluene 3-monooxygenase ferredoxin subunit (Ralstonia pickettii)
M-CRESOL-METHYLCATECHOL-RXN [EC: 1.14.13.236]; 1.14.13.236 [EC: 1.14.13.236]

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.236

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (110 amino acids)

>GFF1069 Toluene-4-monooxygenase system, ferredoxin component (Xanthobacter sp. DMC5)
MFTRVCKAETVAEGGMRLVIADNHLIVLAWPDNGEIRAFQGVCPHSNAPLNEAEFDGTVL
VCPIHRWTWDLNSGTPLEPQESALAEYPVKVEDGVVYIDTEGIEPLFAAP