Protein Info for GFF1068 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Inner membrane protein CreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details amino acids 25 to 31 (7 residues), see Phobius details transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 349 to 372 (24 residues), see Phobius details amino acids 378 to 396 (19 residues), see Phobius details amino acids 402 to 421 (20 residues), see Phobius details PF06123: CreD" amino acids 6 to 427 (422 residues), 490 bits, see alignment E=3.3e-151

Best Hits

Swiss-Prot: 73% identical to CRED_ECOLI: Inner membrane protein CreD (creD) from Escherichia coli (strain K12)

KEGG orthology group: K06143, inner membrane protein (inferred from 100% identity to stm:STM4590)

Predicted SEED Role

"Inner membrane protein CreD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>GFF1068 Inner membrane protein CreD (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLKSPLLWKMITLGGAMILLLIPLMMVRHTIVERADYRSHVEAAIRQSTSGPQKVVGPLV
AIPVTELYTVLEEEKEVQYKRSYLYFWLPESLLVEGNQNVEARKIGIYQGQVWHTDMAIK
AEFDVARLHELNRPNITLGKPFIVVGVGDARGISAVKAPQVNGETLTVEPGTGLPESREG
IHIPLPDSQWATRNLTLDMSLNLSGTGSFSLVPVGRSSEMTLASNWPHPNFVGDFLPGKR
EISGSGFQAQWQTSRFATNLGEQFADAQKVDWDNLPAFSVAVSTPADQYQLTDRATKYAI
LLITLTFMAFFVFETLTGQRLHPMQYLLVGLSLVMFYLLLLALSEHIGFTPAWIAASLVG
ALMNSVYLQAVLKGWRNSVLFTLALLALDGVMWGLLRSEDSSLLLGTGVLLLALGGVMFL
TRHLDWYSLSCQQRKSLPPVKDDELRLWK