Protein Info for GFF1064 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 transmembrane" amino acids 223 to 244 (22 residues), see Phobius details PF05228: CHASE4" amino acids 58 to 178 (121 residues), 31.6 bits, see alignment E=2.5e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 261 to 418 (158 residues), 125 bits, see alignment E=1.3e-40 PF00990: GGDEF" amino acids 263 to 416 (154 residues), 136.1 bits, see alignment E=1.4e-43 PF00563: EAL" amino acids 440 to 668 (229 residues), 220.7 bits, see alignment E=2.8e-69

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (695 amino acids)

>GFF1064 hypothetical protein (Xanthobacter sp. DMC5)
VAGLVGVFIYAGMKQDEKAGMRERLALLAALQAHESLIQQAMATSEDEKQVLTQLAAGDL
ARLHERFGRRLNEGFGLEFIYITDANGDVLYSSENGKPGERKAYAWIRPAVARALAEGRA
GRAGLVASKDGAGILVARPFSERTDDIKAPQPLVAVTVDLLDDSLLQSLAAPAHLHDVQL
RTGRGATNHPDRVGTAVPNLYDGTEAELAWRGAQPGRSLLRNALPALAVLTTLLSVTFLV
MMFRAMRVAAVLAESEAQAREMASRDYLTGLFNRGYFIEALESALAGLASDQRLVLLFID
LDDFKLINDTAGHGAGDLLLKAVAGRIATAIGERGVVGRFGGDEFVAFFPAAHPGEIDEV
LNRLRAELKPPVPDGAGEIRVSASIGVAEAPQDAVSASDLMRRADIALYRAKDTGGDTLC
RFDTQLESERNARREIESALGGALERGELVISYQPQVDVVSGRVVGFETLLRWDHPRLGR
LLPAQFIAMAEEMHIIAGLDLYGMRRACIEAAALPGMSISVNIAPATMKAPDFAEQVATI
LRETHFDPARLEIEVPETIVLNTAAELSRTFEALRALGVGIALDDYGTGYASLHHVSRFP
ISRIKIDRSFTLKACTDPDVAAVIEHKLKLAQSLRINVTAEGVETREQLRFLRAIGMPTA
QGYLFAPPLPIAAAIDMLRRQDETLQASAGGAARA