Protein Info for GFF1061 in Xanthobacter sp. DMC5

Annotation: Glutaredoxin 4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 TIGR00365: monothiol glutaredoxin, Grx4 family" amino acids 4 to 100 (97 residues), 152.9 bits, see alignment E=1.1e-49 PF00462: Glutaredoxin" amino acids 16 to 80 (65 residues), 72 bits, see alignment E=1.9e-24

Best Hits

Swiss-Prot: 58% identical to YC64L_SYNY3: Uncharacterized monothiol glutaredoxin ycf64-like (slr1846) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K07390, monothiol glutaredoxin (inferred from 94% identity to xau:Xaut_4088)

Predicted SEED Role

"Uncharacterized monothiol glutaredoxin ycf64-like" in subsystem Glutaredoxins or Glutathione: Redox cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (112 amino acids)

>GFF1061 Glutaredoxin 4 (Xanthobacter sp. DMC5)
MGIRDDIDAIVKSGDVVLFMKGTPQFPQCGFSGQVVQILDHVGVPFKGVNVLENDMIRQG
IKDYANWPTIPQLYIKGEFVGGCDIVREMFQSGELVPLLEEKGVAIRDRAIG