Protein Info for GFF1059 in Sphingobium sp. HT1-2

Annotation: TldE protein, part of TldE/TldD proteolytic complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF01523: PmbA_TldD_1st" amino acids 34 to 90 (57 residues), 32.2 bits, see alignment 1.5e-11 PF19290: PmbA_TldD_2nd" amino acids 121 to 224 (104 residues), 44.9 bits, see alignment E=2e-15 PF19289: PmbA_TldD_3rd" amino acids 231 to 447 (217 residues), 247.1 bits, see alignment E=1.7e-77

Best Hits

Swiss-Prot: 41% identical to PMBA_ECO57: Metalloprotease PmbA (pmbA) from Escherichia coli O157:H7

KEGG orthology group: K03592, PmbA protein (inferred from 87% identity to sjp:SJA_C1-00840)

MetaCyc: 41% identical to metalloprotease subunit TldE (Escherichia coli)
3.4.24.-

Predicted SEED Role

"TldE protein, part of TldE/TldD proteolytic complex"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>GFF1059 TldE protein, part of TldE/TldD proteolytic complex (Sphingobium sp. HT1-2)
MLSLEEAQSRAQDLVTAARKAGADAADAIYACNASTTVAVRLGALEDVERSEGEEIGLRV
FIGQRSASISASDMNPATLATLIDRSIAMAREAPEDPYAGLAPEDRLLRKRAPSLDLVDD
EEPEPAALRERALIAEEAARSIPGITNSEGGGAASGRSQVALATSHGFAGAYAATNHSTW
ASVLAGSGADMQRDHASHASRHLKDLDDAEAVGMRAGQRAVARLNPGKVDSGVMPVIFDP
RIGSSLVGHLIGGMVGPAIARRSSFLLDSLGETLFDSKITIIDDPLLPRGLRSRPFDGEG
LPVERRALIEDGVLTGWLMDSASARQLGLEPTGHASRGGAGAPGAGITNVHMEAGSLSVG
ELMADVKRGIYVTELIGMGVNGVTGDYSRGAAGFLIENGAVGPAVSEITIAGNLKDMFRT
LVPANDLMFRYAMNVPTLRVDGMTVAGG