Protein Info for GFF1058 in Xanthobacter sp. DMC5

Annotation: Phosphoribosylformylglycinamidine synthase subunit PurQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01737: phosphoribosylformylglycinamidine synthase I
  • amino acids 1 to 226 (226 residues), 296.3 bits, E=6.4e-93
• PF13507: GATase_5
  • amino acids 4 to 211 (208 residues), 130.7 bits, E=8.1e-42
• PF07685: GATase_3
  • amino acids 20 to 95 (76 residues), 36.9 bits, E=4.7e-13
• PF01965: DJ-1_PfpI
  • amino acids 42 to 101 (60 residues), 29.7 bits, E=7.9e-11

Best Hits

Swiss-Prot: 66% identical to PURQ_BRADU: Phosphoribosylformylglycinamidine synthase subunit PurQ (purQ) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K01952, phosphoribosylformylglycinamidine synthase [EC: 6.3.5.3] (inferred from 94% identity to xau:Xaut_4091)

MetaCyc: 52% identical to phosphoribosylformylglycinamidine synthetase subunit I (Bacillus subtilis subtilis 168)
Phosphoribosylformylglycinamidine synthase. [EC: 6.3.5.3]

Predicted SEED Role

"Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit (EC 6.3.5.3)" in subsystem De Novo Purine Biosynthesis (EC 6.3.5.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (4/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.3

Use Curated BLAST to search for 6.3.5.3

Protein Sequence (232 amino acids)

>GFF1058 Phosphoribosylformylglycinamidine synthase subunit PurQ (Xanthobacter sp. DMC5)
MKPAVILFPGSNREQDAVRALRLVAGAKPQVVWHAEHELPKGTDLVVLPGGFSYGDYLRC
GAIAARANIMDAVRAHAARGGLVLGICNGFQILCEAGLLPGVLVRNARLRFVCREVLLRV
ERADTPFTKAYRKGELIRIPVAHGEGNFTASEANLARIEGDGRVAFRYARRDGQIDETDG
PNGAINGIAGIYSEKFNVLGMMPHPENYIEPEIGPTDGRGLFESLAGALKAA