Protein Info for GFF1055 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 164 to 180 (17 residues), see Phobius details amino acids 187 to 203 (17 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details amino acids 250 to 266 (17 residues), see Phobius details amino acids 272 to 289 (18 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 5 to 284 (280 residues), 88 bits, see alignment E=3.2e-29

Best Hits

KEGG orthology group: None (inferred from 67% identity to sjp:SJA_C1-34490)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>GFF1055 hypothetical protein (Sphingobium sp. HT1-2)
VTKNPSIDLLKGLLILLVMGGHAMELTHQQHVLLWIGSGFRMPLMIGISGYLLNVTRTRS
MPMGEMFSRYGRRMLLPWAVAMLVYWLASGGLLSWQTPLDLLLRPPFHLWYVPALFLLIL
VTRLLPLSPLLLLAIGAPVSLATMYSFGLDHGAVGGSLLSPDSRFLRYPVYFFFGMLMAE
RGMPKRYLWPVLLVGALGLFWWSDLYGTGNALAFVPARLLMCLALIALLPSISAVRLHFG
PINRIGRESLFFYLWHPLVMGLVAMLDPHGAVILAGAVLLLYIASALAGQGRLPPLLLGA
VPHRRPAPVVAQPEPAAVTA