Protein Info for GFF1052 in Xanthobacter sp. DMC5

Annotation: putative manganese efflux pump MntP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 64 (26 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details PF02659: Mntp" amino acids 31 to 180 (150 residues), 165.7 bits, see alignment E=3.5e-53

Best Hits

Swiss-Prot: 76% identical to MNTP_XANP2: Putative manganese efflux pump MntP (mntP) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: None (inferred from 76% identity to xau:Xaut_4096)

MetaCyc: 50% identical to Mn2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-487

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (186 amino acids)

>GFF1052 putative manganese efflux pump MntP (Xanthobacter sp. DMC5)
MSPATILVLAMSMSMDAFAVSVGRGAAMGRPRVSEALRTGMVFGLVEAATPVIGWAAGLA
ASSYVEAVDHWIAFALLGGVGLHMLASAFFAREEEKAPRGRSLPILLATAVGTSIDAMAV
GVSLAFLDVNIWITAAAIGLTTFIMSSGGMLLGRLVGARFGRVAEVVAGVALVAIGATIL
IEHLSA