Protein Info for GFF1050 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details

Best Hits

KEGG orthology group: K09943, hypothetical protein (inferred from 75% identity to net:Neut_0622)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>GFF1050 putative membrane protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSYGLLLALHLLAAIAFVGTVFFEVVMLEGVRRHLPHETMREVERVIGNRATAVMPWVLL
TLYAAGIGLASQHRAALMQPLASSFGLLLALKIALALSVLGHFMTAMVWRRRGVLGGRRS
RRLHRSVFCHVMVIVLLAKAMLYLQW