Protein Info for GFF1049 in Xanthobacter sp. DMC5

Annotation: Tyrosine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 TIGR00234: tyrosine--tRNA ligase" amino acids 9 to 413 (405 residues), 384.7 bits, see alignment E=2.9e-119 PF00579: tRNA-synt_1b" amino acids 35 to 326 (292 residues), 259 bits, see alignment E=6.1e-81 PF22421: SYY_C-terminal" amino acids 334 to 412 (79 residues), 29.9 bits, see alignment E=4.1e-11

Best Hits

Swiss-Prot: 93% identical to SYY_XANP2: Tyrosine--tRNA ligase (tyrS) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 93% identity to xau:Xaut_4474)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>GFF1049 Tyrosine--tRNA ligase (Xanthobacter sp. DMC5)
MTSPSFRSDFLRTLSERGYIHQCSDLERLDAKAAEGPITAYIGFDATASSLHAGHLLSIM
MLRTLQRTGHRPIALMGGGTTKIGDPSGKDEARKMLTDQQISDNIASIRKVFARFLDFDG
GAIMENNAGWLDELKYIPLLREVGPHFTINRMLTFDSVKLRLEREQPLTFLEFNYMILQA
YDFVELNRRHGCMLQMGGSDQWGNIVNGMELGRRMHGADLFALTTPLLTTSSGAKMGKTA
GGAVWLDADLLSPYEYWQYWRNAGDADVERFLKLFTELPLDEIARLAALQGQEINIAKEV
LATEATALLHGREAAEKAKETARTTFEQGALAVDLPTVELPRAKLEAGLPVANAFVEAGL
VASTSEARRQIKGGGLRVNDAAVTDEKASIDLAALTPEGVVKLSMGKKKHVLLKPV