Protein Info for PS417_05315 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 138 to 155 (18 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 84% identity to pfs:PFLU1088)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAU9 at UniProt or InterPro

Protein Sequence (207 amino acids)

>PS417_05315 membrane protein (Pseudomonas simiae WCS417)
MKRCVAAAALAGWVGLAIQQYLIFHSRWSTGASLLGGLVNFFSFFTVLTNTLVAVVLSYA
VVHRDSAVKRYFLAPGVSSAIAVNIVLVSLAYNVLLRHLWQPEGFQFIADELLHDVMPLL
FVVYWWRCVPKGALRFKHIGLWVLYPLAYFAYVLLRGDLLGQYQYPFIDVGTLGYPQVFV
NAGGILTGFVLIALAVVGLDKWLTRAQ